Protein Info for CCNA_00343 in Caulobacter crescentus NA1000

Annotation: dihydrolipoamide succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01347: dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex
  • amino acids 3 to 401 (399 residues), 623.7 bits, E=8.5e-192
• PF00364: Biotin_lipoyl
  • amino acids 3 to 73 (71 residues), 67.8 bits, E=1.2e-22
• PF02817: E3_binding
  • amino acids 114 to 146 (33 residues), 42.6 bits, see alignment (E = 1.1e-14)
• PF00198: 2-oxoacid_dh
  • amino acids 172 to 400 (229 residues), 288.9 bits, E=5.7e-90

Best Hits

Swiss-Prot: 62% identical to ODO2_BARQU: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (sucB) from Bartonella quintana (strain Toulouse)

KEGG orthology group: K00658, 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC: 2.3.1.61] (inferred from 100% identity to ccr:CC_0340)

Predicted SEED Role

"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)

MetaCyc Pathways

• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Lysine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.61

Sequence Analysis Tools

See A0A0H3C529 at UniProt or InterPro

Protein Sequence (402 amino acids)

>CCNA_00343 dihydrolipoamide succinyltransferase (Caulobacter crescentus NA1000)
MADINTPALGESVTEATVARWTKKVGEAVKKDEILVELETDKVSLEVASPADGVLSAIGA
AEGATVVPGTVLGVVAEGATASAAPAAAPAPKAEAPKPAPAAPAPAAAPAAAPVSPAPAR
IAAESGLDLSKVAGTGKDGRVTKGDALAALEARASAPAPAAAAAAPRALHEREERVKMTR
LRQTIARRLKEAQNSAAMLTTFNEVDMSAVMALRAQYKDVFEKQHGVKLGFMSFFVKAVV
AALKAIPDVNAEIDGQDVIYKNHYDIGVAVGTDKGLVVPVVRDADALNLAGIEKTIGDLG
KRARNGQLAIEDMQGGTFTITNGGIYGSLMSTPILNAPQSGILGMHAIKERPMVINGKIE
IRPMMYLALSYDHRIVDGAGAVTFLVKVKEAIEDPQRLLLEL