Protein Info for CCNA_00332 in Caulobacter crescentus NA1000

Annotation: molybdenum transport system permease protein modB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 6 to 214 (209 residues), 232 bits, see alignment E=2.8e-73 PF00528: BPD_transp_1" amino acids 24 to 210 (187 residues), 66 bits, see alignment E=1.9e-22

Best Hits

Swiss-Prot: 59% identical to MODB_RHOCA: Molybdenum transport system permease protein ModB (modB) from Rhodobacter capsulatus

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 100% identity to ccr:CC_0329)

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C521 at UniProt or InterPro

Protein Sequence (224 amino acids)

>CCNA_00332 molybdenum transport system permease protein modB (Caulobacter crescentus NA1000)
MGEVLWLTAKLAGITTLLLLLLATPLSWWLARGRSPLRTPVTAIVALPIVLPPTVLGFYL
LIALGPNSPLMALLQPFGVRTLAFTFEGLVIGSLIYSLPFAVQPLRNAFLAIGDEPLEAA
ASLGASRAETFWRVALPLALPGYVAAAILTFAHTVGEFGVVMMLGGNIPGETTVLSTEIY
RLVEALEWGEAHRLSLLLLAFAFLVLFVLLALEARSKILLRTRA