Protein Info for CCNA_00330 in Caulobacter crescentus NA1000

Annotation: molybdenum-pterin binding protein mopB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 TIGR00637: ModE molybdate transport repressor domain" amino acids 21 to 112 (92 residues), 101.9 bits, see alignment E=1.7e-33 PF00126: HTH_1" amino acids 23 to 86 (64 residues), 36.6 bits, see alignment E=3.5e-13 TIGR00638: molybdenum-pterin binding domain" amino acids 123 to 188 (66 residues), 66 bits, see alignment E=2.4e-22 PF03459: TOBE" amino acids 125 to 187 (63 residues), 66.8 bits, see alignment E=1.6e-22 amino acids 193 to 253 (61 residues), 46.8 bits, see alignment E=2.9e-16

Best Hits

Swiss-Prot: 47% identical to MOPB_RHOCA: Molybdenum-pterin-binding protein MopB (mopB) from Rhodobacter capsulatus

KEGG orthology group: K02019, molybdate transport system regulatory protein (inferred from 100% identity to ccr:CC_0327)

Predicted SEED Role

"DNA-binding domain of ModE / Molybdate-binding domain of ModE" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C3B5 at UniProt or InterPro

Protein Sequence (256 amino acids)

>CCNA_00330 molybdenum-pterin binding protein mopB (Caulobacter crescentus NA1000)
MSSDADFRASLILKRGGLARVGLERIALLEAVARHGSISAAAKEAGLSYKGAWDGVQALN
NLFEAPLVSAAPGGRAGGAAQVTARGHAVIRAFRAAEREVSAAFARLEADLSSDAELLWS
LGLRTSARNALRGVVTMVSEDEVTATVTLDIGEGLGLIARVTRRSVEDLGLAPGRPAIAL
IKSSFIRLDGAATENRLEGRILDREGGQAAAEVTIGLSAGKSLVATVGADAPGWDLAPGD
AVVVSIAAADIILAVD