Protein Info for CCNA_00316 in Caulobacter crescentus NA1000

Annotation: glutamate 5-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01027: glutamate 5-kinase
  • amino acids 13 to 374 (362 residues), 410.4 bits, E=3.5e-127
• PF00696: AA_kinase
  • amino acids 14 to 243 (230 residues), 149 bits, E=2e-47
• PF01472: PUA
  • amino acids 287 to 359 (73 residues), 79 bits, E=2.1e-26

Best Hits

Swiss-Prot: 100% identical to PROB_CAUVC: Glutamate 5-kinase (proB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 100% identity to ccs:CCNA_00316)

MetaCyc: 44% identical to glutamate 5-kinase (Escherichia coli K-12 substr. MG1655)
Glutamate 5-kinase. [EC: 2.7.2.11]

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-ornithine biosynthesis II (2/3 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-N^δ-acetylornithine biosynthesis (3/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

See B8GYI6 at UniProt or InterPro

Protein Sequence (377 amino acids)

>CCNA_00316 glutamate 5-kinase (Caulobacter crescentus NA1000)
MTSGSQGAFEAARRIVFKVGSALLVDAETGAANRAWLEAFCADAADLRAAGKQVLVVSSG
AVALGRRRLGLTGRKTTLPEKQAAAAAGQSLLMRAWEEAFEPHGIGVAQILLTRDDTEMR
RRWLNARATTETLMGLGVVPVVNENDTVVTEEIRYGDNDRLAARVAQMAGADLLVLLSDI
DGLYTADPRKNPKAQHIPRVSEITPEIAGMAEGANAAAGVGTGGMATKIAAARIARAAGC
ATLITLGSRPRPLAAIAAGEKATLIEAGASPAAAYKAWIAGSLAPQGWVTVDAGAASALL
AGKSLLPAGVRAVEGPFDKGDAVRVRDENGREVARGLVRYDSADAQRIAGLRSDAIEAEL
GFTEGPMIHADDLAVAH