Protein Info for CCNA_00315 in Caulobacter crescentus NA1000

Annotation: 3-polyprenyl-4-hydroxybenzoate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00148: decarboxylase, UbiD family
  • amino acids 6 to 468 (463 residues), 502 bits, E=6.7e-155
• PF20695: UbiD_N
  • amino acids 10 to 86 (77 residues), 75.8 bits, E=3.5e-25
• PF01977: UbiD
  • amino acids 132 to 335 (204 residues), 266.5 bits, E=1.7e-83
• PF20696: UbiD_C
  • amino acids 341 to 465 (125 residues), 163 bits, E=4.9e-52

Best Hits

Swiss-Prot: 64% identical to UBID_ALTMD: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD1) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K03182, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [EC: 4.1.1.-] (inferred from 100% identity to ccr:CC_0313)

MetaCyc: 62% identical to 3-octaprenyl-4-hydroxybenzoate decarboxylase (Escherichia coli K-12 substr. MG1655)
3-OCTAPRENYL-4-OHBENZOATE-DECARBOX-RXN [EC: 4.1.1.98]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• plastoquinol-9 biosynthesis II (1/5 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (3/8 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.98

Sequence Analysis Tools

See A0A0H3C3A6 at UniProt or InterPro

Protein Sequence (509 amino acids)

>CCNA_00315 3-polyprenyl-4-hydroxybenzoate decarboxylase (Caulobacter crescentus NA1000)
MAYRSLREFIDVLEAKGELVRVKEPVSSVLEMTEIQTRLLATGGPAVLFEHVLLPDGSRS
EMPALANLFGTVKRVAMGVTLGGEPRETAGELREVGELLAFLRQPQPPKGLKDALDMLPL
AKTVMSMRPGTVKKAPVQEVVLTGDQIDLSKLPVQTCWPGEPAPLITWPLVVTKGPSKDR
EDDFNLGIYRMQVLSKDKCIMRWLAHRGGAQHYARHKKAGSKEPLPACAVLGADPGTILA
AVTPVPDTLSEYQFAGLLRGAKVDLVPAKTVPLMVPAHAEIVIEGHVLLDEYADEGPYGD
HTGYYNSVEKFPVFQVTAITMRKDPIYLTTFTGRPPDEPSVLGEALNEVFIPLIRQQFPE
IVDFWLPPEGCSYRIAVVSMKKAYPGHAKRVMLGVWSYLRQFMYTKWVIVVDHDINARDW
KDVMWAISTKMDPARDITVIEHTPIDYLDFASPESGLGSKIGLDATDKWPPETKREWGEE
IRMDQAVVDKVSDMWGRLGLPGDGKPIWK