Protein Info for CCNA_00305 in Caulobacter crescentus NA1000

Annotation: cobalt-zinc-cadmium resistance protein czcD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 57 to 82 (26 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 217 to 217 (1 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 55 to 326 (272 residues), 248.8 bits, see alignment E=3.2e-78 PF01545: Cation_efflux" amino acids 59 to 245 (187 residues), 136.6 bits, see alignment E=4.7e-44

Best Hits

Swiss-Prot: 36% identical to ZITB_ECOLI: Zinc transporter ZitB (zitB) from Escherichia coli (strain K12)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 100% identity to ccs:CCNA_00305)

MetaCyc: 36% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C394 at UniProt or InterPro

Protein Sequence (341 amino acids)

>CCNA_00305 cobalt-zinc-cadmium resistance protein czcD (Caulobacter crescentus NA1000)
MPHDAHGHAHDHGHGHGHHGHDHAHGHGHGHGHGHHHHGHGHHGHHHHAPKDFGRAFAIG
TALNLGFVIVEATAGILTHSLALLADAGHNLSDVLGLLLAWGATVLAKRAPSARRTYGLR
KGTILASLGNAALLLVAVGAIAWEGVRRFAAPEPVQTGPVMIVAAIGIVINTATALMFMK
GSKEDLNVRGAFLHMAADAAVSAGVVIAALAMTFTGWMWLDPVVSLVIVAVIVLGTWGLL
RDSLDLALDATPRGIDTQKVRDWLAARPGVSEVHDLHIWAMSTTETALTAHVVRQLDADH
DQFLHDACAELASRFNIGHVTIQVESGHGAHACRLAPADVV