Protein Info for CCNA_00295 in Caulobacter crescentus NA1000

Annotation: phosphate transport system protein phoU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 TIGR02135: phosphate transport system regulatory protein PhoU" amino acids 7 to 217 (211 residues), 247.5 bits, see alignment E=5.4e-78 PF01895: PhoU" amino acids 20 to 107 (88 residues), 80.4 bits, see alignment E=5.4e-27 amino acids 124 to 209 (86 residues), 81.4 bits, see alignment E=2.6e-27

Best Hits

Swiss-Prot: 100% identical to PHOU_CAUVC: Phosphate-specific transport system accessory protein PhoU homolog (phoU) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02039, phosphate transport system protein (inferred from 100% identity to ccr:CC_0293)

Predicted SEED Role

"Phosphate transport system regulatory protein PhoU" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GYG5 at UniProt or InterPro

Protein Sequence (230 amino acids)

>CCNA_00295 phosphate transport system protein phoU (Caulobacter crescentus NA1000)
MTEHTVKSYGEELAHLTAEVTRMGGIAESQVADCIAAIARRDGPLAQAVVAGDERLDTLQ
SEIERKAFRLIALRQPMAVDLRHAVAALKISMSLERCGDMAKNIGKRALILTEADPMSAL
TRSIERMGKLVQGRLKDVLDAYTTSDLQRAIGVWSRDEEVDEHYNAIFRELLTYMMGDPR
TINACTHLLFVAKNLERIGDHATNIAEIIHFELTGEELTSQRPKLDVLSQ