Protein Info for CCNA_00294 in Caulobacter crescentus NA1000

Annotation: phosphate transport ATP-binding protein pstB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 27 to 274 (248 residues), 392.1 bits, see alignment E=4.5e-122 PF00005: ABC_tran" amino acids 43 to 198 (156 residues), 106.2 bits, see alignment E=2.2e-34

Best Hits

Swiss-Prot: 100% identical to PSTB_CAUVN: Phosphate import ATP-binding protein PstB (pstB) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 100% identity to ccr:CC_0292)

MetaCyc: 54% identical to phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.27 or 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GYG4 at UniProt or InterPro

Protein Sequence (274 amino acids)

>CCNA_00294 phosphate transport ATP-binding protein pstB (Caulobacter crescentus NA1000)
MTVQSPDDSTRAPATSTAAPATADPKIKARGVKVFYGDKQALFDVDLDIPAKSVTAFIGP
SGCGKSTFLRCINRMNDTIPSARVEGSILIDGADVNAKSVDPVVLRSRVGMVFQKPNPFP
KTIFENVAYGPRIHGLATGKAELEAIVESSLKKAGLWNEVADRLHQPGTGLSGGQQQRLV
IARAIAVSPEVILMDEPCSALDPIATAKIEELIDELRSQFCIVIVTHSMAQAARVSQRTA
FFHLGKLVESGPTEEMFTNPRDSRTQDYITGRFG