Protein Info for CCNA_00292 in Caulobacter crescentus NA1000

Annotation: phosphate transport system permease protein pstC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 230 to 260 (31 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 304 to 322 (19 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details amino acids 446 to 468 (23 residues), see Phobius details PF12501: DUF3708" amino acids 7 to 183 (177 residues), 101.3 bits, see alignment E=4.6e-33 TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 171 to 472 (302 residues), 279 bits, see alignment E=1.9e-87 PF00528: BPD_transp_1" amino acids 252 to 471 (220 residues), 59.6 bits, see alignment E=3.4e-20

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 100% identity to ccs:CCNA_00292)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C383 at UniProt or InterPro

Protein Sequence (477 amino acids)

>CCNA_00292 phosphate transport system permease protein pstC (Caulobacter crescentus NA1000)
MLTWLSLIVLALFSSVAFAAGRRRAKTAAAGRARVLHSLPDYYGAYVALWAGIPAALLLL
LGVMFGGRVEDAILQSTRPAAVQALEPDRQAVFYSDVRAIAAKQAPSEVVYEGEQKVALD
AKVAEAQRIETLLNTGMLGGAGVLALAGFLLAFPRINPEFRARNRVEGWTSVLLIACSVA
AVLTTLGIVMSLIWESWRFFQSVNPLSFLLGTEWSPQIAMRADQVASTGAFGAVPLFAGT
FLIMLIAMLVAAPIGLYSAIYLSEYAGRTVRGVVKPLLEILAGVPTVVYGFFAALTVGPL
FRSAFNAIGAALPPGPLATYLMEVQNQMALVAGVVMGIMLIPFVSSLSDDIINAVPQSLR
DGSYAMGATKSETVKKVVLPAALPGIMAAMLLAVSRAVGETMIVTMAAGLQAKLTANPLD
TVTTVTVQIVTLLTGDQEFDSPKTLSAFGLGLTLFVVTLTLNIVALRIVQKYREQYD