Protein Info for CCNA_00278 in Caulobacter crescentus NA1000

Annotation: glutaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR03814: glutaminase A" amino acids 12 to 305 (294 residues), 367.9 bits, see alignment E=1.7e-114 PF04960: Glutaminase" amino acids 24 to 305 (282 residues), 339.2 bits, see alignment E=9.1e-106

Best Hits

Swiss-Prot: 100% identical to GLSA_CAUVN: Glutaminase (glsA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K01425, glutaminase [EC: 3.5.1.2] (inferred from 100% identity to ccr:CC_0276)

Predicted SEED Role

"Glutaminase (EC 3.5.1.2)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 3.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GYE8 at UniProt or InterPro

Protein Sequence (306 amino acids)

>CCNA_00278 glutaminase (Caulobacter crescentus NA1000)
MKALSIPDVLAEVAVLVRPHFGKGKPADYIPQLATVPGGKFGMAVRMVDGDEHVIGDADE
GFSVQSITKVFALGLALNRLGDEIWTRVGKEPSGTPFNHLSLLEAEQGVPRNPFINAGAL
AVTDVLMDVTRDPAALVRDFGGFLCGERLEIDPAVATSELAHAWQNRAIASLMRAKGTIT
HDPEAVVAAYCRQCALSMSCRQLARAFLPLAAGGFSPIAQETVFPERLTRRLNALLLTCG
IYDSVGSFAYRVGLPAKSGVGGGIVAVVPGKATVAVWSPELDRFGTSVVGTAALEAFSQI
TNCSVL