Protein Info for CCNA_00277 in Caulobacter crescentus NA1000

Annotation: succinyl-diaminopimelate desuccinylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 TIGR01246: succinyl-diaminopimelate desuccinylase" amino acids 14 to 380 (367 residues), 436.3 bits, see alignment E=4.6e-135 PF01546: Peptidase_M20" amino acids 71 to 379 (309 residues), 128.7 bits, see alignment E=3e-41 PF07687: M20_dimer" amino acids 180 to 285 (106 residues), 86.7 bits, see alignment E=9.9e-29

Best Hits

Swiss-Prot: 100% identical to DAPE_CAUVC: Succinyl-diaminopimelate desuccinylase (dapE) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01439, succinyl-diaminopimelate desuccinylase [EC: 3.5.1.18] (inferred from 100% identity to ccs:CCNA_00277)

Predicted SEED Role

"N-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18)" in subsystem Arginine Biosynthesis extended or Lysine Biosynthesis DAP Pathway (EC 3.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GYE7 at UniProt or InterPro

Protein Sequence (386 amino acids)

>CCNA_00277 succinyl-diaminopimelate desuccinylase (Caulobacter crescentus NA1000)
MTSPAPVSVSIDPVELAQALIRRPSVTPADAGAMDTLQRQLEALGFACRRMKFGEIENLY
ARRGTARPNLCFAGHTDVVPVGDDAAWTAGPFEAEIKEGVLYGRGAVDMKSAIAAFVAAV
ANVPDHPGSISFLITGDEEGVAEDGTVKVVEALAAEGEIIDHCIVGEPTSANLLGDMVKI
GRRGSINAWITVEGRQGHVAYPHRAANPVPVLVDILSALKARVLDDGYTGFQPSNLEITT
IDVGNTATNVIPAAAKARVNIRFNPAHKGKDLAAWIEGECAKAAEGFDGAATALCKISGE
AFLTEPGDFTDVIVAAVTDATGRAPELSTTGGTSDARFIRALCPVVEFGLVGSTMHQVDE
RVPVEEVRQLAGAYEALIRRYFAAFA