Protein Info for CCNA_00267 in Caulobacter crescentus NA1000

Annotation: MutT-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF09296: NUDIX-like
  • amino acids 37 to 142 (106 residues), 63.4 bits, E=4.2e-21
• PF09297: zf-NADH-PPase
  • amino acids 144 to 175 (32 residues), 55 bits, 7.7e-19
• PF00293: NUDIX
  • amino acids 181 to 284 (104 residues), 68.7 bits, E=8.1e-23

Best Hits

KEGG orthology group: K03426, NAD+ diphosphatase [EC: 3.6.1.22] (inferred from 100% identity to ccr:CC_0266)

Predicted SEED Role

"NADH pyrophosphatase (EC 3.6.1.22)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.22)

MetaCyc Pathways

• NAD salvage pathway II (PNC IV cycle) (5/5 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• NAD salvage pathway I (PNC VI cycle) (4/7 steps found)
• NAD salvage (plants) (4/11 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.22

Sequence Analysis Tools

See A0A0H3C5J2 at UniProt or InterPro

Protein Sequence (313 amino acids)

>CCNA_00267 MutT-like protein (Caulobacter crescentus NA1000)
MPLSIITNTFAGNPLDRDSERRGDEAFLAEKLADPESLAVALWNGKPLVEDILGEDGKPT
GVQIAYLRADMAQDLAGGSEKLLYMGLWKDIAVFAVDIEGAADPAEGPLQGLGRFEELRG
AAASMPPADAGILATAKSMFEWRRRHRWCSACGQKTEVSDGGWKRVCPSCEAEHFPRTDP
VAIMLAIHDGKCLLGRQAMWPQGMFSALAGFIEPGETIEEACARELQEEAGLKATAVRYH
SSQPWPWPSSLMMGLIAEVDSDEAAPDQTELEEVRWFTREEALQLIRGELDGLFAPPPLA
IAHQLIKAWAEEA