Protein Info for CCNA_00264 in Caulobacter crescentus NA1000

Annotation: C4-dicarboxylate transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 5 to 27 (23 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 151 to 168 (18 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 293 to 319 (27 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 352 to 375 (24 residues), see Phobius details PF00375: SDF" amino acids 7 to 401 (395 residues), 378 bits, see alignment E=2.9e-117

Best Hits

Swiss-Prot: 40% identical to GLTT_BACCA: Proton/sodium-glutamate symport protein (gltT) from Bacillus caldotenax

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00264)

Predicted SEED Role

"Na+/H+-dicarboxylate symporters" in subsystem Propionyl-CoA to Succinyl-CoA Module

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C369 at UniProt or InterPro

Protein Sequence (417 amino acids)

>CCNA_00264 C4-dicarboxylate transport protein (Caulobacter crescentus NA1000)
MNKRFAYLIIASMILGVLVGWTCNQFLDPAGAKSAADNLSIITDIFLRLIKMIIAPLVFT
TLVAGVAHMEDAAAVGRIGAKTMTWFIGASAVSLVLGLLMVHLLDPGAGLNMAHVDVAMK
TTATTDAFTLKGFITHLVPTSIFDAMAKNEILQIVVFSLFVGTAVAALDDKAPQILELVE
QAAQIMLKVTGFVMKLAPLAIFAALASTIATQGLGMLATYGKFVLGFYSAMGVLWALLFI
AGLLVLGKRVIPLFGVIRDPVLLAFSTASSEAAYPRILDSLPKVGVRRRIVSFVLPLGYS
FNLDGSMLYCTFATMFIVQAHGVELTVQQQIFMLLLLMVTSKGIAGVPRASLVVIMATLT
YFGLPEAWIALVLGVDHLLDMGRSATNVVGNSVAAAVVAKWEGELDDIPPEGEAAKA