Protein Info for CCNA_00248 in Caulobacter crescentus NA1000

Annotation: sensor histidine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 49 to 69 (21 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 132 to 148 (17 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details PF00512: HisKA" amino acids 239 to 296 (58 residues), 31.9 bits, see alignment 1.1e-11 PF02518: HATPase_c" amino acids 348 to 455 (108 residues), 55.2 bits, see alignment E=9.4e-19

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 100% identity to ccs:CCNA_00248)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C350 at UniProt or InterPro

Protein Sequence (466 amino acids)

>CCNA_00248 sensor histidine protein kinase (Caulobacter crescentus NA1000)
MADVSFARAPDDQRHKGLDKLADEPAQDDAWSWTAPGLRRGRLRVRTLLAQRWAWVVGQT
AVLTFAGLVLKLQVPWALCFTLIALSAWLNVLLGLASSGQRLARDGEATAQIAFDILQLS
GLFYLTGGAQNPFSLLLIAPVTLAAATLPARYALTLGAMAILSSILLALFHLPLPTVDGR
PLPDLSNSNLLWSIVIARIFGIVFTGLYAWQAASESARMELALNVTETVLAREQRLSALG
ALAAAAAHELGTPLATISVVAREMARNAPNDEVREDAELMIGQAARCREILQRLTEMPEA
TDAVHERMSLVQLVQDVIEPHLVHGIRVEAVVNGPSGETAPDIWRRPEIIHAMTSIVENA
VDFARSEVIVIARFDARHIVIEARDDGPGFSPEVLAKLGEPYVTTRPGAEGSRTGHIGMG
LGFFIAKTLLERTGATVDFRNGRRGGAVVSARWPRPALEAPGHTGA