Protein Info for CCNA_00244 in Caulobacter crescentus NA1000

Annotation: HAD superfamily phophatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 TIGR02247: epoxide hydrolase N-terminal domain-like phosphatase" amino acids 2 to 211 (210 residues), 285.5 bits, see alignment E=2.6e-89 PF00702: Hydrolase" amino acids 4 to 188 (185 residues), 48.7 bits, see alignment E=1.3e-16 PF13419: HAD_2" amino acids 95 to 194 (100 residues), 32.2 bits, see alignment E=1.2e-11 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 134 to 193 (60 residues), 45.6 bits, see alignment E=8.1e-16

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to ccr:CC_0244)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C4T3 at UniProt or InterPro

Protein Sequence (213 amino acids)

>CCNA_00244 HAD superfamily phophatase (Caulobacter crescentus NA1000)
MAVEAVIWDFGGVFTTSPFEAFRRYETERGLPKDFIRTVNATDPDANAWARFERAEIDAA
AFDGLFRQEALRLGHDVRGADVLPLLYGDLRPSVMAALKTCKAQFKVGCITNNVPTGHGP
GMAQSAEKALAVGEIMALFDAVIESSKAGVRKPDPRIYQMMCELLGVAPEACIYLDDLGI
NCKPAAALGMTAIKVSDERQLLDDLAKATGLAF