Protein Info for CCNA_00238 in Caulobacter crescentus NA1000

Annotation: two-component sensor histidine kinase chvG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 222 to 245 (24 residues), see Phobius details PF13755: Sensor_TM1" amino acids 21 to 80 (60 residues), 61.9 bits, see alignment E=7.5e-21 PF00672: HAMP" amino acids 240 to 294 (55 residues), 29.6 bits, see alignment 1.4e-10 PF00512: HisKA" amino acids 301 to 364 (64 residues), 50.1 bits, see alignment E=4.6e-17 PF02518: HATPase_c" amino acids 417 to 532 (116 residues), 92.7 bits, see alignment E=4.1e-30

Best Hits

KEGG orthology group: K14980, two-component system, OmpR family, sensor histidine kinase ChvG [EC: 2.7.13.3] (inferred from 100% identity to ccs:CCNA_00238)

Predicted SEED Role

"Sensor histidine kinase ChvG (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C4S8 at UniProt or InterPro

Protein Sequence (534 amino acids)

>CCNA_00238 two-component sensor histidine kinase chvG (Caulobacter crescentus NA1000)
MATVIAKPEAIAPEPKRRFTWPRGSRLGRLIVVLNVVALAIVIVGALILNELRNGLVNAR
IDSLSTQGELIANVIDQSATVGEPEPALDPYTASQIFQLLFIPRSQRARLFDAQGKALAD
SFVVADRVDWKVLPPARKPDQKDDDARTTPDRAAKAKRAQEALANEIAQAMRGRTVAGTR
IAENGERVVSVSIPIQHVKAVLGVLTLEASDVDEIIAAQRKALLPFIAVAMLAILTSSVL
LHRLIAVPVLRLARAADHVRLQGARAISLPDLSERKDELGDLSRSLEDMTHSLSERMDAI
ERFAADVAHEIKNPLTSIRSAIETLDLVTEPAARARLLAILQNDVNRLDRLVTDISNASR
LDAELSREHPKALDLGRLLTEVVSLYENQWRPGDAPGSVRVSLSLADPSQPAIILGRETP
IGQVFRNLIDNARSFSPADGEVRVTLSRTRGGLIAAVEDDGPGMPPENLETIFERFYTSR
PKGRAFGGNSGLGLSIARQIVETHGGTVHAENRKDANGAVVGARFVVELPDARE