Protein Info for CCNA_00234 in Caulobacter crescentus NA1000

Annotation: WecE-family cell wall biogenesis enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 TIGR03588: UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase" amino acids 5 to 385 (381 residues), 504.1 bits, see alignment E=1.2e-155 PF01041: DegT_DnrJ_EryC1" amino acids 12 to 381 (370 residues), 413.9 bits, see alignment E=6.8e-128 PF00155: Aminotran_1_2" amino acids 24 to 169 (146 residues), 33.8 bits, see alignment E=2.2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0234)

Predicted SEED Role

"C4 aminotransferase specific for PseB product (PseC, second step of pseudaminic acid biosynthesis)" in subsystem Pseudaminic Acid Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5G4 at UniProt or InterPro

Protein Sequence (386 amino acids)

>CCNA_00234 WecE-family cell wall biogenesis enzyme (Caulobacter crescentus NA1000)
MTGGFLPYGRQTIEEDDIAAVAEALRGDFLTTGPTVEAFETAFAAKVGADHAIAVSNGTA
TLHLAMMALGIGEGDVCVAPSVTFLATANCARYVGAEVVFADVDPDSGLMTPDTLARALA
GARDKRVKAVLPVHLRGDVCDLPALKAMASASGAVLVEDAPHALGSIATFDGVAHPVGDG
AYSSFASFSFHPVKTLATGEGGMLTTNDPALAAKARLLRSHGMVRQPGGDPWWYEMPELG
FNYRIPDVLCALGLSQLAKLDRFVARRRDLTALYARLLAERAPRARLATSPDHSDAALHL
LTVLIDFEAEGISRRTVVESLKTQGVGTQVHYIPVHRQPYYAQRYGVADLPGADAWYARC
LTLPLYPAMTNGDVERVVGALATVLG