Protein Info for CCNA_00233 in Caulobacter crescentus NA1000

Annotation: UDP-N-acetylglucosamine 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03589: UDP-N-acetylglucosamine 4,6-dehydratase (inverting)
  • amino acids 11 to 339 (329 residues), 513.1 bits, E=1.2e-158
• PF01370: Epimerase
  • amino acids 16 to 238 (223 residues), 83.5 bits, E=5.8e-27
• PF02719: Polysacc_synt_2
  • amino acids 16 to 296 (281 residues), 349.9 bits, E=3.8e-108
• PF04321: RmlD_sub_bind
  • amino acids 16 to 190 (175 residues), 30.7 bits, E=6.3e-11
• PF16363: GDP_Man_Dehyd
  • amino acids 17 to 142 (126 residues), 40.9 bits, E=6.3e-14
• PF01073: 3Beta_HSD
  • amino acids 17 to 147 (131 residues), 57.4 bits, E=4.5e-19
• PF07993: NAD_binding_4
  • amino acids 18 to 150 (133 residues), 35.6 bits, E=2e-12
• PF13460: NAD_binding_10
  • amino acids 20 to 145 (126 residues), 28.8 bits, E=3.8e-10

Best Hits

Swiss-Prot: 62% identical to PSEB_HELPY: UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (pseB) from Helicobacter pylori (strain ATCC 700392 / 26695)

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0233)

MetaCyc: 62% identical to UDP-N-acetylglucosamine 4,6-dehydratase subunit (Helicobacter pylori 26695)
UDP-N-acetylglucosamine 4,6-dehydratase (inverting). [EC: 4.2.1.115]

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

MetaCyc Pathways

• CMP-pseudaminate biosynthesis (5/6 steps found)
• UDP-N-acetyl-β-L-fucosamine biosynthesis (1/4 steps found)
• UDP-N-acetyl-β-L-quinovosamine biosynthesis (1/4 steps found)
• CMP-diacetamido-8-epilegionaminic acid biosynthesis (1/7 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.115

Sequence Analysis Tools

See A0A0H3C4S3 at UniProt or InterPro

Protein Sequence (345 amino acids)

>CCNA_00233 UDP-N-acetylglucosamine 4,6-dehydratase (Caulobacter crescentus NA1000)
MGRFSPKSLDLDGKVILVTGGTGSFGRRFIETVLRRYDPRKVIVYSRDELKQSDMQIELR
EQFDEATVAKMRFFLGDVRDRERLTLALRGVDIVIHAAALKQVPAAEYNPSECIHTNVLG
AENVVWASLANAVKQVVALSTDKACNPTNLYGATKLASDKTFVAANNLSGDIGTRFCVVR
YGNVVGSRGSVVPLYRRLLSQGATELPVTDPRMTRFWITLNEGVDFVLSSLTMMRGGEIF
VPKIPSMAMPDLVKAMSSTAAMKVIGIRPGEKLHEIMISADDARSTVEFDDRYAIEPNFA
EFGREPYAASDGAKPVAEDFSYSSDNNHDWLSPEGLLAMLEEKAT