Protein Info for CCNA_00229 in Caulobacter crescentus NA1000

Annotation: CAAX amino terminal protease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 31 to 58 (28 residues), see Phobius details amino acids 89 to 112 (24 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 232 to 248 (17 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details PF02517: Rce1-like" amino acids 176 to 265 (90 residues), 59.4 bits, see alignment E=1.8e-20

Best Hits

KEGG orthology group: K07052, (no description) (inferred from 100% identity to ccs:CCNA_00229)

Predicted SEED Role

"FIG00482146: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5F9 at UniProt or InterPro

Protein Sequence (324 amino acids)

>CCNA_00229 CAAX amino terminal protease family protein (Caulobacter crescentus NA1000)
MRMGGLMETVRRSRFLADLSPHDRDPRRTALVIPVGILAGAVTGLLGALAAVLAFMLVVG
GLDGAAAATDLFQVFSKPDLAAPTGPQSLFILACLAGMNLGAAIGFVMAAAAIQRRPFSD
YINDGQPLRWRLVLGGLVLVGVVMAVVIGVVAVVSGHVFEPVVLKVSPNLVGRSLYAIIA
IVLLILASAAEELLFRGWLLKQSAAYIRNPIALMALNGLLFAAIHLDPNLDAFLFRAAMG
AGLTWMALRLGGIELGIGVHAANNAAIVLLLRPITLQPDAAREFQPGLVASAVVMLAGFI
GIAELWMRWPALRRWTGLSAPATA