Protein Info for CCNA_00217 in Caulobacter crescentus NA1000

Annotation: thiol:disulfide interchange protein DsbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 716 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 302 to 329 (28 residues), see Phobius details amino acids 350 to 372 (23 residues), see Phobius details amino acids 387 to 408 (22 residues), see Phobius details amino acids 430 to 456 (27 residues), see Phobius details amino acids 462 to 485 (24 residues), see Phobius details amino acids 505 to 522 (18 residues), see Phobius details amino acids 528 to 549 (22 residues), see Phobius details amino acids 561 to 583 (23 residues), see Phobius details PF11412: DsbD_N" amino acids 46 to 158 (113 residues), 70.8 bits, see alignment E=1.6e-23 PF02683: DsbD" amino acids 312 to 490 (179 residues), 40.6 bits, see alignment E=4e-14 PF13899: Thioredoxin_7" amino acids 604 to 689 (86 residues), 80.5 bits, see alignment E=1.2e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00217)

Predicted SEED Role

"Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC 1.8.1.8)" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange (EC 1.8.1.8)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C693 at UniProt or InterPro

Protein Sequence (716 amino acids)

>CCNA_00217 thiol:disulfide interchange protein DsbD (Caulobacter crescentus NA1000)
MFLKKAVLALQALVMGAMLGGHALAGPVVNSGHVESELVAQEAGIAPGGTIYVALRQKIA
PGWHTYWRNPGDAGEPTKITWTLPEGWSAGDMVWPTPVKTRLGPLLDYAYKGEVLIPVPI
TAAANAQPGTTLSLTADVFYLVCEQVCIPEQAKLSLLLPVVAGTPAPDPKWGAVIGKVLA
DAPKPAGLKAVFKLEGQALKLAVTGGPLKGADMAGAYFFPYSSKVIEHAAEQAIERGAEG
LTLTLKPGYDFVGGSTPPAELVGVLATKAGAWEVTATAGEALAGASGLGPPPAEAAPGGA
LAGGLAGALLFAFLGGLILNLMPCVFPVLSMKAASLAGHAHEAPKARLQGLAFLLGVVAT
FLALAGALLAVRAGGAAVGWGFQLQSPLVIAGLALLMLLVALNMSGIFEIGTSVQGVGAG
ASAKGGVSGAFFTGALAVVVAAPCTAPFMAGALGYALTQPPVIALGVFLALALGFAAPFV
AVTFIPGALKLLPRPGDWMEVLKKGLAFPMYGAALWLVWVFAQQAGPIALGQLLVAGVLA
AFGAWLYGLAQARRAVGKGSAVSMILGLLAVVGALALAAASALSAKPPVAAAEASTPSGP
GLTAEAWSPEKVQALQAEGRPILVDFTAAWCVTCQVNEKVALSGPKVAEAFKAQNAVLLK
ADWTNRDPVIAKALADFGRVGVPLYLVYPKNGGEPVILPQLLTEGMVIEAIERAGS