Protein Info for CCNA_00202 in Caulobacter crescentus NA1000

Annotation: DesA-family fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 91 to 107 (17 residues), see Phobius details amino acids 139 to 167 (29 residues), see Phobius details amino acids 204 to 240 (37 residues), see Phobius details PF00487: FA_desaturase" amino acids 55 to 320 (266 residues), 82.3 bits, see alignment E=2.5e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0202)

Predicted SEED Role

"Fatty acid desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C677 at UniProt or InterPro

Protein Sequence (351 amino acids)

>CCNA_00202 DesA-family fatty acid desaturase (Caulobacter crescentus NA1000)
MAKTASDISLTRQAMSLTEDLMTPNAAIYWADLTISAAVMWGGFLIAATTSSLALGLGAA
LLSMLALYRGLSFIHELTHIRDDEAPGFRVGWNVLVGVPLMTPSLMYEGVHNIHHIKDRF
GTRLDPEYLPLSRFTPLKLAGFLFIALLAPLGVILRSAILIPLSFLVPSLRRYLKTKLSA
LIINPDFVREDLGRWRKAWVIQDVACWLWSWAVIAGLGLGVVPVRVVLTGLAIFSLATFL
NQARTLVAHHWDNDGDKMTLEEQFLDSVNVPPPNLASALWAPVGLRYHALHHLLPRLPYH
NMAKAHARLVEALGADSLYHRASEPGLFEALGDLFRRVRQKNAEARNQPAH