Protein Info for CCNA_00198 in Caulobacter crescentus NA1000

Annotation: tRNA (guanine-N1) -methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR00088: tRNA (guanine(37)-N(1))-methyltransferase" amino acids 6 to 232 (227 residues), 238.3 bits, see alignment E=3.4e-75 PF01746: tRNA_m1G_MT" amino acids 29 to 221 (193 residues), 163.1 bits, see alignment E=3.5e-52

Best Hits

Swiss-Prot: 100% identical to TRMD_CAUVC: tRNA (guanine-N(1)-)-methyltransferase (trmD) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00554, tRNA (guanine-N1-)-methyltransferase [EC: 2.1.1.31] (inferred from 100% identity to ccs:CCNA_00198)

Predicted SEED Role

"tRNA (Guanine37-N1) -methyltransferase (EC 2.1.1.31)" in subsystem Ribosome biogenesis bacterial or Wyeosine-MimG Biosynthesis (EC 2.1.1.31)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C302 at UniProt or InterPro

Protein Sequence (245 amino acids)

>CCNA_00198 tRNA (guanine-N1) -methyltransferase (Caulobacter crescentus NA1000)
MPFTATVLTMFPEAFPGPLGVSMIGTAWKEQDLWRLETLDIRAFSKDKRGFLDDTPAGGG
AGAVLKADVIASALDSLERDGRPLLYMSARGRPLTQARVREWSKAPGIVVLCGRFEGVDQ
RVLDARGFEEVSVGDAVLAGGEAAAMVVIEACVRLAPGVLGNIESTLEESFEDGLLEHPQ
YTRPRTFEELDIPEVLLSGDHKKIDQWRKRMREETTRERRPDLWEAHLANQQAKGDPKPG
KPKET