Protein Info for CCNA_00186 in Caulobacter crescentus NA1000

Annotation: guanine-hypoxanthine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 47 to 74 (28 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 131 to 148 (18 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 348 to 367 (20 residues), see Phobius details amino acids 379 to 407 (29 residues), see Phobius details amino acids 419 to 436 (18 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 18 to 395 (378 residues), 153.8 bits, see alignment E=2.8e-49

Best Hits

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 100% identity to ccs:CCNA_00186)

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C2Z3 at UniProt or InterPro

Protein Sequence (438 amino acids)

>CCNA_00186 guanine-hypoxanthine permease (Caulobacter crescentus NA1000)
MIEKTFKLSAQGTTVRTEVLAGVTTFLTMAYIVIVNPAILGQAGMPIAAVAAATCLAAGL
GSILMGLIANYPIALAPGMGLNAYFTFTVVKGMGLPWETALGCVFLSGVAFLILTVAGIR
QLIVGAIPRPLFSAVAAGVGLFIAFIGLKEAGIIVADPATTVALGDLTKPTAVLAILGLL
VMGALMAWRVKGAILIGILVAAGVAWALGLAKIAPGDYGLAALTATAFKLDVPAALHLNG
AFGMALAEVIFVFLFVDLFDNVGTLVAVTKKAGLVQPDGSIPRLNRILTADSIATIGGSL
AGTSTVVSYIESASGVAEGGRTGLTAVVVGLLFLLTLFFAPWVQAIPVAATAPALIVVGA
MMVGALADVDWDDPGVAIPAFLTVIAIPLTFSIANGLAFGITAYAGLTLLRGKAKPKDWL
LFVLAGLFVLRFIYMGKA