Protein Info for CCNA_00183 in Caulobacter crescentus NA1000

Annotation: type II secretory pathway, prepilin signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 85 to 114 (30 residues), see Phobius details amino acids 127 to 144 (18 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details PF06750: A24_N_bact" amino acids 14 to 95 (82 residues), 79.8 bits, see alignment E=1.3e-26 PF01478: Peptidase_A24" amino acids 106 to 214 (109 residues), 76.4 bits, see alignment E=2.2e-25

Best Hits

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 100% identity to ccr:CC_0184)

Predicted SEED Role

"General secretion pathway protein O"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C4N1 at UniProt or InterPro

Protein Sequence (253 amino acids)

>CCNA_00183 type II secretory pathway, prepilin signal peptidase (Caulobacter crescentus NA1000)
MTIDHLWAVSALILAPFVGSFIGLLTLRLPADRPWAMSRSACDTCKRRLGVVDLVPLVSF
LVLRGRCRTCGTAIPRRYPLLEGGCLVIALWSVLAFSGGMILLTALMGWSLLLIATIDTE
HLWLPDRLTLPFGALGVIATLAIGEVPVWTPLVGAAVGFGGLALIAWLYKTVRGFDGMGG
GDPRLLGAIGAWVGWQGLPSVLVWACVAGLSVAIAQTLVRRRFSGDQQLPFGAFLAIGAW
LTWLWGPLHALLT