Protein Info for CCNA_00176 in Caulobacter crescentus NA1000

Annotation: type II secretion pathway protein H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 transmembrane" amino acids 41 to 66 (26 residues), see Phobius details PF07963: N_methyl" amino acids 39 to 62 (24 residues), 30.9 bits, see alignment (E = 1.5e-11) TIGR01708: type II secretion system protein H" amino acids 39 to 178 (140 residues), 92 bits, see alignment E=3.2e-30 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 40 to 63 (24 residues), 29.1 bits, see alignment (E = 6e-11) PF12019: GspH" amino acids 78 to 175 (98 residues), 38 bits, see alignment E=2.2e-13

Best Hits

KEGG orthology group: K02457, general secretion pathway protein H (inferred from 100% identity to ccs:CCNA_00176)

Predicted SEED Role

"General secretion pathway protein H"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C2Y5 at UniProt or InterPro

Protein Sequence (185 amino acids)

>CCNA_00176 type II secretion pathway protein H (Caulobacter crescentus NA1000)
MAPSMSIRSARTAARAAKARTPTLATGAEARHAKARRVAQAGFTLVELMVVLMIMGLLAT
AVILTLPEGKMSLSQESARFAARLLRAREESLLVNRQVRVNVTSADYRFDIRDGRAWRAL
DTAPFVTTAWVEETRVSGRDGATVVVFEPTGQASGAEFTLGRGGSGYVVSVDVAGNVAVH
AAQAL