Protein Info for CCNA_00163 in Caulobacter crescentus NA1000

Annotation: exopolysaccharide transport family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 739 transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 449 to 475 (27 residues), see Phobius details amino acids 693 to 710 (18 residues), see Phobius details PF02706: Wzz" amino acids 21 to 111 (91 residues), 38.8 bits, see alignment E=2.5e-13 PF13807: GNVR" amino acids 395 to 466 (72 residues), 40.5 bits, see alignment E=5.3e-14 TIGR01007: capsular exopolysaccharide family" amino acids 524 to 728 (205 residues), 114.2 bits, see alignment E=2.9e-37 PF13614: AAA_31" amino acids 543 to 687 (145 residues), 48 bits, see alignment E=3.7e-16 PF09140: MipZ" amino acids 544 to 592 (49 residues), 23 bits, see alignment 1.2e-08 PF01656: CbiA" amino acids 545 to 594 (50 residues), 30.4 bits, see alignment 8.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0164)

Predicted SEED Role

"FIG00481980: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C4L4 at UniProt or InterPro

Protein Sequence (739 amino acids)

>CCNA_00163 exopolysaccharide transport family protein (Caulobacter crescentus NA1000)
MDGSRFETSNAPVNDTGALSFDLNIAIATFRRRFRLFAAVAVVVFAAVVLFTLQQTPKYT
AIAQVMLDVRQEQVTDMSAVLSGLPADSSVVDTEVEVLKSRSLAARVVKELKLEQDPYFN
PYLSNAEGAGAWLSTVRKAAAPLDNVDSVELQRRSERIVDSVLGGLKVRRAGLTYLISIE
YTHKDPKRASELANAFANLYLTEQLEAKFDATQKANEWLDTRVGELREQVQAADAAVQQY
KIQNNLLSAEGATLTEQEISSLNQQLALSRASQAETDARLNIARQQLARGSTGEDVGESL
NSPVVQQLRKQRSEKSAQVADLGGRYGDRHPELLKARRELADIDGQIQAEIRRIISNLEA
QAQVARQRTGSVASSVAASKGTLAGNNRASIGLAELERKAQSVKTLYETLLSRFKQTTTQ
EGIEQADARVVSPAKIPTRPSYPKPTLNLALGLVLALGAGVAAVVLAEILMAGLFTEDEV
ERRLGLPYLGAVPSLGTTVDDSKTLKGMTPPDYLLVKPLSSFAESLRKLRASILFSKVGE
TVQVIAVTSSLPGEGKTTTTFSLARTLATSGAKVIVVDCDLRQSAISQFLKEPAPVGLLE
VLNGVATLDQAIINDESGAHILPLAKSSYTPRDVLGSSAMHRLLGELRGRYEIVLLDTAP
LLAIADTRILAPHTDAVVMLVRWKKTPVKAVQSALALLQGTRAFIAGVALTQMDLKAQSR
YGYGDSYYYYANYRKYYAD