Protein Info for CCNA_00156 in Caulobacter crescentus NA1000

Annotation: ArsR-family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 PF12840: HTH_20" amino acids 15 to 59 (45 residues), 46.6 bits, see alignment E=2.7e-16 PF01022: HTH_5" amino acids 17 to 59 (43 residues), 23.6 bits, see alignment E=3.8e-09

Best Hits

KEGG orthology group: None (inferred from 54% identity to kfl:Kfla_1112)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C4L0 at UniProt or InterPro

Protein Sequence (95 amino acids)

>CCNA_00156 ArsR-family transcriptional regulator (Caulobacter crescentus NA1000)
MAEQSETLDAVFQALADPTRRAILSRLGQGPASVGELAAPHDMALTSFMKHLKILERSGW
IVSAKTGRVRTCAIVTDRFADVGAWVYGHRSLWEG