Protein Info for CCNA_00116 in Caulobacter crescentus NA1000

Annotation: phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 5 to 138 (134 residues), 148.6 bits, E=1.8e-47
• TIGR01455: phosphoglucosamine mutase
  • amino acids 7 to 446 (440 residues), 624.9 bits, E=3.3e-192
• PF02879: PGM_PMM_II
  • amino acids 161 to 258 (98 residues), 69 bits, E=9.4e-23
• PF02880: PGM_PMM_III
  • amino acids 262 to 368 (107 residues), 125.4 bits, E=2.5e-40
• PF00408: PGM_PMM_IV
  • amino acids 380 to 446 (67 residues), 61.4 bits, E=1.4e-20

Best Hits

Swiss-Prot: 100% identical to GLMM_CAUVN: Phosphoglucosamine mutase (glmM) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 100% identity to ccr:CC_0117)

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10) / Phosphomannomutase (EC 5.4.2.8)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis or Alginate metabolism or Mannose Metabolism (EC 5.4.2.10, EC 5.4.2.8)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• colanic acid building blocks biosynthesis (10/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• GDP-mannose biosynthesis (3/4 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (9/14 steps found)
• glycogen degradation II (3/6 steps found)
• chitin biosynthesis (5/9 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• sucrose biosynthesis II (4/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (1/4 steps found)
• starch degradation III (1/4 steps found)
• starch degradation V (1/4 steps found)
• peptidoglycan recycling I (8/14 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• glycogen degradation I (3/8 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (1/8 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• starch biosynthesis (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• streptomycin biosynthesis (2/18 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.10, 5.4.2.8

Use Curated BLAST to search for 5.4.2.10 or 5.4.2.8

Sequence Analysis Tools

See B8GXK7 at UniProt or InterPro

Protein Sequence (448 amino acids)

>CCNA_00116 phosphoglucosamine mutase (Caulobacter crescentus NA1000)
MSKRAYFGTDGIRGQANKHPMTAEVALRVGLAAGKLFRSQDERRHLVVIGKDTRLSGYMI
EPALVAGLTSVGLDVRLFGPLPTPAVAMMTRSMRADLGIMISASHNSFADNGIKLFGPDG
YKLSDAQELGIEALMDQGLQEGLAAPRELGRVKRIDDAQARYVEIVKATFPRHLNLSGLR
IVIDCANGAAYKVAPTALYELGAEVITLGVSPDGTNINEECGSTHPEAMAKMVREYRADI
GIALDGDADRLVICDEKGVVVDGDQIMAIIAAASHKAGTLKGGGVVATVMSNLGLERQLN
TMGLSLERTAVGDRYVMQRMREGGFNVGGEQSGHLILSDFSTTGDGLIAALQVLAVMVET
DKPMSALGRQFEPVPQLLENVRFVGGKPLEAAAVKEAIADGEAQLNGAGRIVVRASGTEP
LIRIMAEGDDPALVKKVVKSIASAVKAA