Protein Info for CCNA_00090 in Caulobacter crescentus NA1000

Annotation: UDP-glucose 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF04321: RmlD_sub_bind" amino acids 3 to 154 (152 residues), 55.6 bits, see alignment E=1.4e-18 PF02719: Polysacc_synt_2" amino acids 4 to 172 (169 residues), 47.5 bits, see alignment E=4.4e-16 PF01370: Epimerase" amino acids 4 to 252 (249 residues), 186 bits, see alignment E=2.4e-58 TIGR01179: UDP-glucose 4-epimerase GalE" amino acids 4 to 322 (319 residues), 404.2 bits, see alignment E=1.7e-125 PF16363: GDP_Man_Dehyd" amino acids 5 to 313 (309 residues), 188.1 bits, see alignment E=9.1e-59 PF01073: 3Beta_HSD" amino acids 5 to 152 (148 residues), 50.5 bits, see alignment E=4.7e-17 PF07993: NAD_binding_4" amino acids 69 to 178 (110 residues), 25.7 bits, see alignment E=1.8e-09

Best Hits

Swiss-Prot: 64% identical to EXOB_RHILT: UDP-glucose 4-epimerase (exoB) from Rhizobium leguminosarum bv. trifolii

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to ccs:CCNA_00090)

MetaCyc: 50% identical to UDP-xylose 4-epimerase subunit (Sinorhizobium meliloti 1021)
UDP-arabinose 4-epimerase. [EC: 5.1.3.5]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C4G6 at UniProt or InterPro

Protein Sequence (327 amino acids)

>CCNA_00090 UDP-glucose 4-epimerase (Caulobacter crescentus NA1000)
MQTVLVTGGAGYVGSHCCLALAEAGFRPVVFDDLSNGHREHVQWGPLEVGDIRDAARLDA
VFAAYAPVAVLHFAARIEVGESVKNPGAFFDTNVGGTITLIEAARRAGVKVVVFSSTCAT
FGDPVDLPMKETHPQAPLNPYGRSKLMVEQALADYDRYVGLKSAVMRYFNAAGADPQGRI
GEWHEPETHAVPLAIQVALGQRPRFTIFGDDYDTRDGTAVRDYVHVLDLADAHVAALKRL
LVGGSSETYNLGTGTGTTVRELVDGVGKVAGAPLPVEIASRRPGDAPVLVGDHAKARAEL
GWKASRSLDEILSTAWRWHRGRLEQEP