Protein Info for CCNA_00083 in Caulobacter crescentus NA1000

Annotation: phosphoglucomutase/phosphomannomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01132: phosphoglucomutase, alpha-D-glucose phosphate-specific
  • amino acids 2 to 545 (544 residues), 894.5 bits, E=1.1e-273
• PF02878: PGM_PMM_I
  • amino acids 39 to 178 (140 residues), 109.8 bits, E=1.8e-35
• PF02879: PGM_PMM_II
  • amino acids 207 to 317 (111 residues), 39.3 bits, E=1.6e-13
• PF02880: PGM_PMM_III
  • amino acids 321 to 441 (121 residues), 99.6 bits, E=2.5e-32
• PF00408: PGM_PMM_IV
  • amino acids 478 to 540 (63 residues), 30.5 bits, E=6e-11

Best Hits

Swiss-Prot: 60% identical to PGM_ECOLI: Phosphoglucomutase (pgm) from Escherichia coli (strain K12)

KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] (inferred from 100% identity to ccs:CCNA_00083)

MetaCyc: 70% identical to phosphoglucomutase (Mycobacterium tuberculosis H37Rv)
Phosphoglucomutase. [EC: 5.4.2.2]

Predicted SEED Role

"Phosphoglucomutase (EC 5.4.2.2)" (EC 5.4.2.2)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• colanic acid building blocks biosynthesis (10/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• glycogen degradation II (3/6 steps found)
• chitin biosynthesis (5/9 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• sucrose biosynthesis II (4/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (1/4 steps found)
• starch degradation III (1/4 steps found)
• starch degradation V (1/4 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• glycogen degradation I (3/8 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (1/8 steps found)
• starch biosynthesis (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• streptomycin biosynthesis (2/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.2

Use Curated BLAST to search for 5.4.2.2

Sequence Analysis Tools

See A0A0H3C2P3 at UniProt or InterPro

Protein Sequence (546 amino acids)

>CCNA_00083 phosphoglucomutase/phosphomannomutase (Caulobacter crescentus NA1000)
MMHDRAGLRALPEDLVDLDALIGAYFEIKPDVSNPAQKVVFGTSGHRGSSLDGAFNEAHI
LAVTQAIVEYRAAQGVTGPLFVGRDTHGLSEPAWRSVLEVLAANGVEALVDSRDGFTPTP
AVSHAILTHNRQGGRQADGLLLTPSHNPPRDGGIKYNPPSGGPAGSDATSAIAARANELL
AQGLAGVKRVPFETARKAVGDYDFLGRYVDDLPAVIDIAAIRAAKVRIGADPLGGAAVAY
WGAIAERHALDLTVVNDAVDPRWAFMPLDTDGKIRMDCSSSSAMANLIGIMKGGAAYDVA
TGNDADADRHGIVTPDGGLMNPNHYLAAAISYLFSHRPGWGADTAVGKTLVSSSMIDRVV
SGLGRRLLEVPVGFKYFVPGLLDGSVGFGGEESAGAAFLRHDGGVWTTDKDGIQLALLAA
EIQAVTGKSASQLYAGLTDQYGAPAYARVDAPASREEKARLSKLSPSDVSAKTLAGEAIT
DILTAAPGNGEAIGGLKVCTQNAWFAARPSGTEDVYKVYAESFLGADHLKQVQAEAREVV
AGALKG