Protein Info for CCNA_00068 in Caulobacter crescentus NA1000

Annotation: NAD(P)H-dependent glycerol-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02737: 3HCDH_N
  • amino acids 10 to 53 (44 residues), 23.5 bits, 1.6e-08
• PF03807: F420_oxidored
  • amino acids 10 to 108 (99 residues), 24.1 bits, E=1.6e-08
• PF01210: NAD_Gly3P_dh_N
  • amino acids 10 to 163 (154 residues), 151.5 bits, E=6.8e-48
• PF02558: ApbA
  • amino acids 11 to 116 (106 residues), 32.4 bits, E=2.4e-11
• PF07479: NAD_Gly3P_dh_C
  • amino acids 184 to 324 (141 residues), 169.1 bits, E=2.3e-53
• PF20618: GPD_NAD_C_bact
  • amino acids 244 to 310 (67 residues), 75.5 bits, E=1.3e-24

Best Hits

Swiss-Prot: 100% identical to GPDA_CAUVC: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (gpsA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 100% identity to ccs:CCNA_00068)

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• phosphatidylglycerol biosynthesis I (5/6 steps found)
• phosphatidylglycerol biosynthesis II (5/6 steps found)
• glycerol-3-phosphate shuttle (1/2 steps found)
• CDP-diacylglycerol biosynthesis III (3/5 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (7/12 steps found)
• 1,3-propanediol biosynthesis (engineered) (4/9 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (5/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (7/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Sequence Analysis Tools

See A0A0H3C4E8 at UniProt or InterPro

Protein Sequence (336 amino acids)

>CCNA_00068 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase (Caulobacter crescentus NA1000)
MTLQPMTFEKVGVIGAGAWGTALAQVAARAGLAVTLQAREPEIVAAINDTHENAVFLPGI
ALEPGIKAVADLADLADCDLILAVAPAQHLRAALTAFAPHRKAGAPVVLCSKGVEQGSLK
LMTDVAAEALPGAPIAVLSGPSFAGEVARNLPAAVTLACEDEALGRAIAEAIAIPTFRPY
TANDLIGAEAGGAVKNVLAIACGIVEGKGLGRNAHATVITRGFAELTRLAVALGARPETV
AGLCGLGDLVLTCSSPQSRNMSVGLALGQGLTLEQALAGKVSVAEGVASAPAVRALARKV
GVEAPICEAVAAILAGEVAVDAAIAGLLSRPLKPEA