Protein Info for CCNA_00056 in Caulobacter crescentus NA1000

Annotation: ribosomal-protein-S18-alanine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00583: Acetyltransf_1
  • amino acids 14 to 122 (109 residues), 59.6 bits, E=7.5e-20
• PF13508: Acetyltransf_7
  • amino acids 51 to 122 (72 residues), 35.6 bits, E=2e-12
• PF13673: Acetyltransf_10
  • amino acids 55 to 126 (72 residues), 29.7 bits, E=1.1e-10
• PF08445: FR47
  • amino acids 66 to 125 (60 residues), 30.3 bits, E=6.8e-11

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 100% identity to ccr:CC_0058)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.128

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Sequence Analysis Tools

See A0A0H3C3N4 at UniProt or InterPro

Protein Sequence (150 amino acids)

>CCNA_00056 ribosomal-protein-S18-alanine acetyltransferase (Caulobacter crescentus NA1000)
MNLRPVGSEAAFDLADLHDKAFDRPWTALEFDDLLKSPGAFAILGEAGEPAEAKGFILCR
SIAGEAEILTVAVDPAARRRGWGAALVEVAAGIAAETKAEAMFLEVAADNLAAIALYQTT
GFLKVGLRKGYYPHPDGAKDALVMRRALNT