Protein Info for CCNA_00043 in Caulobacter crescentus NA1000

Annotation: N utilization substance protein A NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 TIGR01953: transcription termination factor NusA" amino acids 11 to 352 (342 residues), 423 bits, see alignment E=7.8e-131 PF08529: NusA_N" amino acids 11 to 134 (124 residues), 99.1 bits, see alignment E=6.1e-32 PF00575: S1" amino acids 141 to 204 (64 residues), 25.7 bits, see alignment E=3.7e-09 PF13184: KH_5" amino acids 239 to 305 (67 residues), 100.7 bits, see alignment E=1.2e-32 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 374 to 423 (50 residues), 76.8 bits, see alignment 1e-25 PF14520: HHH_5" amino acids 374 to 421 (48 residues), 23 bits, see alignment 2.6e-08

Best Hits

KEGG orthology group: K02600, N utilization substance protein A (inferred from 100% identity to ccr:CC_0044)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C3M7 at UniProt or InterPro

Protein Sequence (548 amino acids)

>CCNA_00043 N utilization substance protein A NusA (Caulobacter crescentus NA1000)
MAIGIAANRLELLQIADAVAREKGIEKEVVIEAIEDALQKAARARYGAEHDIRVKIDPKT
GETTQKRVIEVVSDDAELEGEIGKMPFSIAKRTWRDAEIGKVYEEVLPPFEIGRVQTQMA
RQVVMHKVREAERERQYDEYKDRVGEIVNGSVKRVEYGNVIVDLGRGEGIMRRDQSIPRE
NFNVGDRIRAYIYDVRRETKGPQIMLSRAHGGFMAKLFAQEVPEVYDGVIEIRAVARDPG
SRAKMAVISNDGSIDPVGACVGMRGSRVQAVVAELQGEKIDIIQWSEDEATFIVNALAPA
EVSKVVMDEEDERVEVVVPDEQLSLAIGRRGQNVRLASQLTGWQIDIMTESQESERRQRE
FAERTALFQEALDVDEVIAQLLVTEGFAAVEDVAYVEPHEIASIEGFDEETAEELQTRAR
EFLEKEAAELDAKRKALGVEDELLTIEGVTLAMAVALGEGDVKSIEDLAGLVPDDMRGWF
ENKGGERVREPGILESFNLSPEDAEALIMRARIAMGWVEAPPEPEPEPEFEEESSAEGDV
VAEAEEEA