Protein Info for CCNA_00027 in Caulobacter crescentus NA1000

Annotation: 2OG-Fe(II) oxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF13640: 2OG-FeII_Oxy_3" amino acids 85 to 178 (94 residues), 52.6 bits, see alignment E=7.5e-18 PF18331: PKHD_C" amino acids 185 to 228 (44 residues), 70.8 bits, see alignment 7.7e-24

Best Hits

Swiss-Prot: 100% identical to Y027_CAUVC: PKHD-type hydroxylase CC_0027 (CC_0027) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K07336, PKHD-type hydroxylase [EC: 1.14.11.-] (inferred from 100% identity to ccs:CCNA_00027)

Predicted SEED Role

"Iron-uptake factor PiuC" in subsystem Transport of Iron

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C539 at UniProt or InterPro

Protein Sequence (229 amino acids)

>CCNA_00027 2OG-Fe(II) oxygenase (Caulobacter crescentus NA1000)
MPMMLQIPEVLTKAQVAECRAILDAGPWVDGNVTSGFQAAMAKNNEQLPQDSAEARHVGA
IIVQALEANPLFVSAALPRTILSPMFNRYGEGMGFRDHVDNAIRRDPVTGQRLRTDLSCT
LFLAEPEDYDGGELVVNDLYGDHVVKLAAGDAILYPSTSLHHVTTVTRGRRTASFFWIQS
LIRDDARRSLLLDMDVAIQQLSRKVERDDEAILSLTGVYHNLLRQWAEV