Protein Info for CCNA_00018 in Caulobacter crescentus NA1000

Annotation: molybdenum cofactor biosynthesis protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 23 to 349 (327 residues), 370 bits, see alignment E=5.1e-115 PF04055: Radical_SAM" amino acids 36 to 199 (164 residues), 109.4 bits, see alignment E=3.3e-35 PF13353: Fer4_12" amino acids 39 to 144 (106 residues), 29.2 bits, see alignment E=1.5e-10 PF06463: Mob_synth_C" amino acids 205 to 330 (126 residues), 132 bits, see alignment E=2e-42

Best Hits

Swiss-Prot: 100% identical to MOAA_CAUVC: GTP 3',8-cyclase (moaA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to ccr:CC_0018)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5R8 at UniProt or InterPro

Protein Sequence (349 amino acids)

>CCNA_00018 molybdenum cofactor biosynthesis protein A (Caulobacter crescentus NA1000)
MTPYDDSPAQAVSTAPRTTGPSLIDGFGRAVTYLRVSVTDRCDLRCVYCMAEHMTFLPKA
EVLTLEELDRLASTFVGLGVRKLRLTGGEPLVRKGFIGLVARLSRHLSSGALDELTLTTN
GSQLERYASDLARHGVRRINVSLDTLKPALFRALTRGGDVTRVIAGIDAAQAAGMTVKIN
AVALKHDNAGEIPALIQWAHGRGCDITLIETMPLGEVDQDRTDQFLSLQDVRRDLSSFWT
LTDIPDSTGGPARYVHVAETGGRLGLITPLSNHFCDTCNRVRLTCTGTLHTCLGRDDASD
LRAEIRRGASDAELVDAIHLAIGAKPKGHDFQIAAAQPAVARHMSTTGG