Protein Info for CCNA_00016 in Caulobacter crescentus NA1000

Annotation: molybdopterin converting factor, large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02391: MoaE
  • amino acids 6 to 117 (112 residues), 113.7 bits, E=2.6e-37

Best Hits

Swiss-Prot: 100% identical to MOAE_CAUVC: Molybdopterin synthase catalytic subunit (moaE) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03635, molybdopterin synthase catalytic subunit [EC: 2.-.-.-] (inferred from 100% identity to ccr:CC_0016)

MetaCyc: 46% identical to molybdopterin synthase catalytic subunit (Escherichia coli K-12 substr. MG1655)
RXN-8342 [EC: 2.8.1.12]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaE" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (3/6 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.1.12

Sequence Analysis Tools

See A0A0H3C497 at UniProt or InterPro

Protein Sequence (150 amino acids)

>CCNA_00016 molybdopterin converting factor, large subunit (Caulobacter crescentus NA1000)
MIVTLTDQPFEPGVLVSAFCAGREETGAVATFIGLARAEQGAARALELEAYPGFTDAAIT
EIAQGAVTRFALQDVHIVHRVGVIAPGEAIVFVATAAAHRREAFEACDYLMDYLKSRAPF
WKKEHGPEGPRWIEPTARDRTDAQRWDQEA