Protein Info for CCNA_00012 in Caulobacter crescentus NA1000

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 903 TIGR01070: DNA mismatch repair protein MutS" amino acids 19 to 898 (880 residues), 770.6 bits, see alignment E=1.2e-235 PF01624: MutS_I" amino acids 19 to 135 (117 residues), 140.3 bits, see alignment E=7.5e-45 PF05188: MutS_II" amino acids 144 to 271 (128 residues), 69.7 bits, see alignment E=8.4e-23 PF05192: MutS_III" amino acids 288 to 593 (306 residues), 138.2 bits, see alignment E=1.1e-43 PF05190: MutS_IV" amino acids 458 to 553 (96 residues), 66.1 bits, see alignment E=7e-22 PF00488: MutS_V" amino acids 652 to 838 (187 residues), 273.9 bits, see alignment E=2e-85

Best Hits

Swiss-Prot: 100% identical to MUTS_CAUVC: DNA mismatch repair protein MutS (mutS) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 100% identity to ccr:CC_0012)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C2I6 at UniProt or InterPro

Protein Sequence (903 amino acids)

>CCNA_00012 DNA mismatch repair protein MutS (Caulobacter crescentus NA1000)
MNAHATPTPAHEIDPTGATPVMAQFFEMKARQPDALIFFRMGDFYELFFDDAYKAAAALG
ISQTFRGTHNGQPIPMAGVPQHAAEAYLSKLIRLGFKVAVCEQMEDPAEAKKRGSKAVVR
RDIVRVVTPGTLTEDGLLDARGANRLAAVALRAGQAAVASVELSTGEVEVLAVAKEGVAP
ILAALAPSETLVADRLLSDDSLSQTLRICGGLVQPMPSALSEPQASETRVKRLYGVETLD
GFGGLSPAEIGALGLIAAHLEMTQAGRLPALRAPRRAADADVMAIDPATRSSLEIDRTQS
GDRNGSLLAAIDRTVTAGGARMLASRLARPLLDVAAIDQRLDAVEWFVEHRQLRQRLREV
LKGAGDMARALSRLALGRGGPRDLGCIRDTLKVGERLAGMAGGAPDPLSPPPFELEHAFK
ALTPALHEGLSQFLTTLEHGLGPDLPALARDGGFVAAGVRPELDQARGLRDDSRKVIAAL
ESQLALESGVPLKIRHNGVLGYFVEATAGKADPLFQPPLNATFIHRQTLANQVRFTTVEL
ADLDARIAQAAERALAMEVAAFEDWREQARLLADAIQIASEALARIDVASSLAEWAEDAG
AVRPVVDASYAFDAKAARHPVVEAAVKRAGEPYTPNDCRLDASGETAARLSIVTGPNMAG
KSTFLRQNALLAILAQSGCYVPAASFRLGVVDRLFSRVGAGDDLARGRSTFMMEMVETAS
ILTQAGPRSLVILDEIGRGTATYDGLAIAWACAEALHDTNRCRALFATHYHELATLETRM
AFVSNLSLRAKEWNGDLVFLHEAAPGPADRSYGVQVAKLAGVPAPVVVRAREVLDRLESK
DQSPAKLDDLPLFAVSQAVAVTSAPAKAAPSAVETSLADLDVDGMSPREALEALYRLKGL
LTA