Protein Info for CCNA_00006 in Caulobacter crescentus NA1000

Annotation: enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 16 to 261 (246 residues), 278.3 bits, E=5.4e-87
• PF16113: ECH_2
  • amino acids 19 to 190 (172 residues), 120.3 bits, E=1.4e-38

Best Hits

Swiss-Prot: 60% identical to ECHA8_MYCTU: Probable enoyl-CoA hydratase echA8 (echA8) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to ccr:CC_0006)

MetaCyc: 65% identical to acryloyl-CoA hydratase (Ruegeria pomeroyi DSS-3)
RXN-6383 [EC: 4.2.1.116]

Predicted SEED Role

No annotation

MetaCyc Pathways

• oleate β-oxidation (29/35 steps found)
• adipate degradation (5/5 steps found)
• 2-methyl-branched fatty acid β-oxidation (11/14 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (8/10 steps found)
• adipate biosynthesis (4/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (4/5 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• β-alanine biosynthesis II (4/6 steps found)
• 3-hydroxypropanoate cycle (9/13 steps found)
• acrylate degradation I (3/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• propanoyl-CoA degradation II (3/5 steps found)
• superpathway of the 3-hydroxypropanoate cycle (12/18 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• acrylate degradation II (1/3 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• glyoxylate assimilation (8/13 steps found)
• valproate β-oxidation (5/9 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (2/5 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• phenylacetate degradation I (aerobic) (4/9 steps found)
• superpathway of phenylethylamine degradation (5/11 steps found)
• 3-phenylpropanoate degradation (4/10 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.116 or 4.2.1.17

Sequence Analysis Tools

See A0A0H3C490 at UniProt or InterPro

Protein Sequence (262 amino acids)

>CCNA_00006 enoyl-CoA hydratase (Caulobacter crescentus NA1000)
MAQFQTLIVEAPESAPGVTLIRLNRPEALNALNTALLGELAQALAAAQADDSVGCIVLTG
SAKAFAAGADIKEMSDKTYAQMFKADFFTAGARAIEQCRKPIIAAVAGYALGGGCELAMM
CDFILAADTAKFGQPEINLGVAPGIGGTQRLTRFVGKSKAMDMILTGRMMGAEEAERSGL
VSRIFPADSLVDETLAIAAKIAGQSPLAVAMNKELVEAAYETTLTTGVALERRLFHSLFA
FEDQKEGMTAFVEKRKPLFKGA