Protein Info for CCNA_00004 in Caulobacter crescentus NA1000

Annotation: dephospho-CoA kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01121: CoaE
  • amino acids 2 to 176 (175 residues), 142 bits, E=8.6e-46
• TIGR00152: dephospho-CoA kinase
  • amino acids 3 to 186 (184 residues), 129 bits, E=9.5e-42

Best Hits

Swiss-Prot: 100% identical to COAE_CAUVC: Dephospho-CoA kinase (coaE) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 100% identity to ccs:CCNA_00004)

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Sequence Analysis Tools

See A0A0H3C2I0 at UniProt or InterPro

Protein Sequence (199 amino acids)

>CCNA_00004 dephospho-CoA kinase (Caulobacter crescentus NA1000)
MLILGLTGSIGMGKSTTSKMFQDEGVPVYDADAAVHALYASGGAAVAPVETAFPGVVVDG
AIDRAKLSAQVVGNSEALAKLEAIVHPLVGAHRIGFFEQAKAEGHEIVVLDIPLLFETGG
EKRVDKVVVVSAPAEVQRERVLARPEMTPEKFEAILARQTPDADKRARADFVIDTGQGLD
HARRQVRDLLTLLRTARSA