Protein Info for CA265_RS25425 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: NAD-dependent dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 18 to 279 (262 residues), 30.3 bits, E=5.8e-11
• PF01370: Epimerase
  • amino acids 19 to 254 (236 residues), 166.8 bits, E=1.5e-52
• PF16363: GDP_Man_Dehyd
  • amino acids 20 to 315 (296 residues), 173.2 bits, E=2.7e-54
• PF01073: 3Beta_HSD
  • amino acids 20 to 235 (216 residues), 31 bits, E=3.5e-11

Best Hits

Swiss-Prot: 51% identical to UXS5_ARATH: UDP-glucuronic acid decarboxylase 5 (UXS5) from Arabidopsis thaliana

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 88% identity to psn:Pedsa_3846)

MetaCyc: 54% identical to UDP-xylose synthase 1 subunit (Sinorhizobium meliloti 1021)
UDP-glucuronate decarboxylase. [EC: 4.1.1.35]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• UDP-α-D-xylose biosynthesis (2/2 steps found)
• dTDP-4-O-demethyl-β-L-noviose biosynthesis (4/5 steps found)
• O-antigen building blocks biosynthesis (E. coli) (8/11 steps found)
• dTDP-α-D-mycaminose biosynthesis (3/5 steps found)
• dTDP-3-acetamido-3,6-dideoxy-α-D-glucose biosynthesis (3/5 steps found)
• dTDP-β-D-fucofuranose biosynthesis (2/4 steps found)
• dTDP-6-deoxy-α-D-allose biosynthesis (2/4 steps found)
• dTDP-N-acetylthomosamine biosynthesis (2/4 steps found)
• dTDP-N-acetylviosamine biosynthesis (2/4 steps found)
• dTDP-L-daunosamine biosynthesis (3/6 steps found)
• dTDP-sibirosamine biosynthesis (3/6 steps found)
• dTDP-3-acetamido-α-D-fucose biosynthesis (2/5 steps found)
• dTDP-β-L-digitoxose biosynthesis (3/7 steps found)
• dTDP-β-L-olivose biosynthesis (3/7 steps found)
• dTDP-α-D-ravidosamine and dTDP-4-acetyl-α-D-ravidosamine biosynthesis (2/6 steps found)
• dTDP-D-desosamine biosynthesis (2/6 steps found)
• dTDP-β-L-4-epi-vancosamine biosynthesis (3/8 steps found)
• dTDP-β-L-megosamine biosynthesis (3/8 steps found)
• dTDP-β-L-mycarose biosynthesis (2/7 steps found)
• UDP-sugars interconversion (3/9 steps found)
• dTDP-α-D-forosamine biosynthesis (3/9 steps found)
• dTDP-α-D-olivose, dTDP-α-D-oliose and dTDP-α-D-mycarose biosynthesis (3/9 steps found)
• superpathway of enterobacterial common antigen biosynthesis (3/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
• superpathway of novobiocin biosynthesis (5/19 steps found)
• superpathway of erythromycin biosynthesis (2/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (11/33 steps found)
• superpathway of megalomicin A biosynthesis (3/22 steps found)
• superpathway of dTDP-glucose-derived antibiotic building blocks biosynthesis (3/23 steps found)

KEGG Metabolic Maps

• Biosynthesis of vancomycin group antibiotics
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.1.1.35 or 4.2.1.46

Sequence Analysis Tools

See A0A1X9ZC06 at UniProt or InterPro

Protein Sequence (342 amino acids)

>CA265_RS25425 NAD-dependent dehydratase (Pedobacter sp. GW460-11-11-14-LB5)
MNERKEKSPSGDVGAKKRILITGAAGFLGSHLCDRFVKEGYHVIGMDNLITGDMANIEHL
FKLENFEFYNHDVSKFVHIPGKLHYILHFASPASPIDYLKIPIQTLKVGSLGTHNLLGLA
RNKNARMLIASTSEVYGDPNVNPQPEEYWGNVNPVGPRGVYDEAKRFQEAITMAYHTFHG
VETRIVRIFNTYGPRMRLNDGRVLPAFIGQALRGEDLTIFGDGSQTRSFCYVDDLIEGIY
RLLMSDYAQPVNIGNPDEITIKQFCEEIIKLTGTTQKIVYKELPQDDPKQRRPDITKART
ILGWEPKVGRAEGLKITYEYFKSLPAEALEKIDHKDFTTFNR