Protein Info for CA265_RS25410 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: gluconate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF13671: AAA_33" amino acids 5 to 137 (133 residues), 37.5 bits, see alignment E=4.2e-13 PF01583: APS_kinase" amino acids 5 to 102 (98 residues), 29.6 bits, see alignment E=9.3e-11 TIGR01313: carbohydrate kinase, thermoresistant glucokinase family" amino acids 5 to 162 (158 residues), 193 bits, see alignment E=1.5e-61 PF01202: SKI" amino acids 12 to 163 (152 residues), 49.6 bits, see alignment E=7.7e-17

Best Hits

KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 50% identity to pct:PC1_3943)

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZC10 at UniProt or InterPro

Protein Sequence (168 amino acids)

>CA265_RS25410 gluconate kinase (Pedobacter sp. GW460-11-11-14-LB5)
MAGFIILMGVSGSGKTVIGKALAPKINAEFIDGDNLHSQRNVDKMAAGIPLTDADRLDWL
QLIAKVGREHVAHGTSCIIACSALKKSYRNLLRNDNPSIRFVYLQGSFGLIHDRIAKRSH
QYMPASLLKSQFETLEEPLADEGDVVTVLIDQSIPEIVNEIVKADLIS