Protein Info for CA265_RS25340 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 15 to 61 (47 residues), 26.9 bits, 8.8e-10
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 22 to 461 (440 residues), 366.9 bits, E=6.9e-114
• PF05958: tRNA_U5-meth_tr
  • amino acids 262 to 467 (206 residues), 68.5 bits, E=1.4e-22
• PF02475: Met_10
  • amino acids 286 to 385 (100 residues), 26.2 bits, E=1.7e-09
• PF13847: Methyltransf_31
  • amino acids 324 to 415 (92 residues), 39.4 bits, E=1.3e-13
• PF09445: Methyltransf_15
  • amino acids 325 to 406 (82 residues), 23.5 bits, E=9e-09

Best Hits

Swiss-Prot: 61% identical to Y643_BACTN: Uncharacterized RNA methyltransferase BT_0643 (BT_0643) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 81% identity to phe:Phep_3623)

Predicted SEED Role

"RNA methyltransferase, TrmA family"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A0A1X9ZC46 at UniProt or InterPro

Protein Sequence (470 amino acids)

>CA265_RS25340 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Pedobacter sp. GW460-11-11-14-LB5)
MSRRKPGTVTIVPNVHIIDIAEEGKGVGKADELVIFVDKAVPGDVVDVRLTKKKKNFAEA
IIDQLHEKSALRTDPFCPHFGTCGGCKWQHMGYDAQLKFKQKNVEAALQRLGKIDTSGTE
PILGSAKNRYYRNKLEFTFSNKRWLEKTDVERDEDLDMNALGFHVPLRFDKILDIEHCYL
QDEPSNSIRNAVRNYALENSLSFYDLRNHEGVLRNLIIRTSSTGEVMVAVVFAYPEQAQV
DGLMAFLQNEFPQITSLLYIVNQKKNDTIFDQDVVLFSGRDHIFEEMDGIRFKIGVKSFY
QTNSEQAFELYKITRDFAGFKGDELVYDLYTGAGTIANFIAKNVKQVVGVEYVPTAIQDA
KFNSALNGIDNTIFYAGDMKDILTSEFILAHGKPDVVITDPPRAGMHADVVQRLLEMESE
KIVYVSCNAATQARDLELLKEKYDVVRIKPVDMFPHTQHVENVVLLRFKG