Protein Info for CA265_RS25275 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: TIGR00159 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details PF19293: CdaA_N" amino acids 8 to 86 (79 residues), 68.2 bits, see alignment E=5.6e-23 TIGR00159: TIGR00159 family protein" amino acids 9 to 262 (254 residues), 217.1 bits, see alignment E=1.3e-68 PF02457: DAC" amino acids 128 to 245 (118 residues), 133.9 bits, see alignment E=2.2e-43

Best Hits

KEGG orthology group: None (inferred from 83% identity to phe:Phep_3664)

Predicted SEED Role

"Diadenylate cyclase spyDAC; Bacterial checkpoint controller DisA with nucleotide-binding domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZD67 at UniProt or InterPro

Protein Sequence (263 amino acids)

>CA265_RS25275 TIGR00159 family protein (Pedobacter sp. GW460-11-11-14-LB5)
MKGLDFDFVKFTITDVVDIVLVALLIYYVYTLIRNTLAVNLLVGMLIIAIFYRVVDALHM
KLLTAIIEKFMSVGIIALIVIFHPEIRRFLLLIGKNAFLQKNKAWWGYLFGRKEIERNNL
TRIKPIIDACKSMKKTRTGALMVFVKFYDEQFFANSCELVDAKISKRLLESIFQKNSPLH
DGAVVISENKIKSASCILPLTDNDQLPSQFGLRHRAGIGVSETTDAVAVIISEETGEISY
AKQGRVRMNVSFGELEKLLNKDF