Protein Info for CA265_RS25245 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details PF10067: DUF2306" amino acids 35 to 182 (148 residues), 134.7 bits, see alignment E=1.5e-43

Best Hits

KEGG orthology group: None (inferred from 48% identity to chu:CHU_1836)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZBX4 at UniProt or InterPro

Protein Sequence (187 amino acids)

>CA265_RS25245 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MMQITLRYIPLSSEVSFLQIKQTEVSGIKAYLPIFYVHVYSAIFVLLAGFTQFNPTILAQ
YPKVHQWLGYLYVGFVLLLAAPSGIFIGWFANGGLMAKTSFIILGILWFWFTLKAVQLIL
KRKIIAHQKFMYRSFALATSAITLRLWKVILVYLFHPDPMDVYQIIAWLGWIPNLLIAEW
LIRKKII