Protein Info for CA265_RS25175 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 53 (19 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details PF00892: EamA" amino acids 3 to 142 (140 residues), 46.3 bits, see alignment E=2.4e-16 amino acids 155 to 287 (133 residues), 48.6 bits, see alignment E=4.6e-17

Best Hits

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZBW7 at UniProt or InterPro

Protein Sequence (301 amino acids)

>CA265_RS25175 EamA family transporter (Pedobacter sp. GW460-11-11-14-LB5)
MLKGILLVFFGACSFGILSTFVKLAYHEGYTLGDVTGAQAFFGAVILWMLFFFQRRTASY
KAKAIVPQTPWWKMVLAGTCTGLVSIFYYQCVKLVPNSVAIILLMQFIWMSILMEYLIFK
KKPTGLQLFAILLVLGGTVLASGMAETSIESMDLKGIGFGLLAAICYAGFLLLSGRIGNE
YAPLQKSALMITGACILIFIIFPPTFLYNGALNGSLLKWGLIISVFGTVIPPLFFAEGVP
RIGTAMSSILSAAELPVAVMMAGFVLQEQVSFLRWIGVVVILSAMVLPNLKYLKKGRGWE
G