Protein Info for CA265_RS24970 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF20030: bpMoxR" amino acids 18 to 214 (197 residues), 38.9 bits, see alignment E=1.8e-13 PF07726: AAA_3" amino acids 47 to 176 (130 residues), 212.9 bits, see alignment E=4.3e-67 PF07728: AAA_5" amino acids 47 to 174 (128 residues), 51.1 bits, see alignment E=5e-17 PF00004: AAA" amino acids 48 to 157 (110 residues), 26.5 bits, see alignment E=2.8e-09 PF17863: AAA_lid_2" amino acids 250 to 318 (69 residues), 49.6 bits, see alignment E=9.3e-17

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 83% identity to phe:Phep_0488)

Predicted SEED Role

"MoxR protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZBT5 at UniProt or InterPro

Protein Sequence (320 amino acids)

>CA265_RS24970 AAA family ATPase (Pedobacter sp. GW460-11-11-14-LB5)
MQYKNEVEAVDALHQSFNNIKAEISKVVVGQDDIIKSVLIAIFSNGHCLLVGVPGLAKTL
LVQTVASVLDLDFNRIQFTPDLMPSDIIGAEILGEDRHFKFIKGPVFSNIILADEINRTP
PKTQAALLEAMQEKSVTAAGQTHILPKPFFVLATQNPIEQEGTYPLPEAQLDRFMFNIQL
NYPAFADELNIVKNTTSNKTVQLQKIIHADDIQYFQKLIRDIPITDNVLEYAVKLAAKTR
PNSEFATDAINKYISWGAGPRASQFLVLGAKCHAAVSGKYSPDIEDVKAVAEPILRHRIV
RNYRAEAEGLSIEKIIKDLL