Protein Info for CA265_RS24540 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: sodium-independent anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 47 to 84 (38 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 274 to 297 (24 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details amino acids 332 to 352 (21 residues), see Phobius details amino acids 363 to 396 (34 residues), see Phobius details PF00916: Sulfate_transp" amino acids 18 to 365 (348 residues), 182.9 bits, see alignment E=8.3e-58 PF01740: STAS" amino acids 411 to 491 (81 residues), 34.5 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: None (inferred from 77% identity to phe:Phep_2681)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZBL9 at UniProt or InterPro

Protein Sequence (511 amino acids)

>CA265_RS24540 sodium-independent anion transporter (Pedobacter sp. GW460-11-11-14-LB5)
MKPYLQLFDFSKKVNYKTEILAGLTVAMTMIPESLSFAILAGFPPLTGLYAAFIMGLVTA
ILGGRPGLVSGGAGATVIVLIALMKTQGIEYVFAAVALAGLIQIMVGLFKLGKFVRLVPQ
PVMFGFVNGLAVIIFMSQLEQFKTLVDGRITWLSGTPLYVMLALVLLTVAIVIILPKITK
AVPASLVAIIVVFLIVLCFGIDTKLVKNIASVNGGFPPFHIPKVPLNLDMLKIIFPYSLI
MAGVGLTEGLLTLNLVDEITASKGNRNRESIAQGIANIANGFFTGMGGCPMIAQTLVNLS
AGARARLSGIIAALTILLIILVGAPVIDRVPMAALVGVMMMVAIGTFEWMSFKVINKMPA
QDIIIGILVAVITVWLHNLALAVLIGVILSALVFAWESSKRIRASKHTDASGVKTYEIFG
PLFFGSIANFNELFDVAHDPQHIVIDFKHSRVFDMSGIDALNKLTERYRSLDKKLQLKHL
SNDCKRLLKNADQIIEVNIIEDPIYQVATER