Protein Info for CA265_RS24225 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase" amino acids 10 to 338 (329 residues), 219.8 bits, see alignment E=2.4e-69 PF01565: FAD_binding_4" amino acids 31 to 154 (124 residues), 69.6 bits, see alignment E=2.3e-23 PF02873: MurB_C" amino acids 215 to 338 (124 residues), 93.2 bits, see alignment E=9.8e-31

Best Hits

Swiss-Prot: 47% identical to MURB_PSEPK: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 70% identity to phe:Phep_3702)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZBD7 at UniProt or InterPro

Protein Sequence (338 amino acids)

>CA265_RS24225 UDP-N-acetylenolpyruvoylglucosamine reductase (Pedobacter sp. GW460-11-11-14-LB5)
MLQIQENISLKPYNSFGIDVKASYFAEISVEADLIKLFKQEIVKSQKLLVIGGGSNVLFT
QDYDGLVVKISIKGIQSSAIDGKVLVTAGAGEVWNDFVNYCVAHHFAGVENLSLIPGTVG
ASPIQNIGAYGVELKDVFESCTAFEIKTGKIKTFSYADCHFGYRESIFKGELKGQYIITA
VTFRLSAEAKINTSYGAIETELLNRGIERPNIADVSAAVSHIRVSKLPDPSTIGNAGSFF
KNPVIEKYEFADIVAKHPDVVHYATADDKIKLAAGWLIEQCGWKGKVVGQTGTWKNQALV
LVNHGQATGTEVYNFSEQIIDSVKSTFGVTLEREVNIL