Protein Info for CA265_RS24150 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 TIGR01350: dihydrolipoyl dehydrogenase" amino acids 2 to 467 (466 residues), 573.4 bits, see alignment E=1.7e-176 PF07992: Pyr_redox_2" amino acids 3 to 329 (327 residues), 229.5 bits, see alignment E=3.3e-71 PF01134: GIDA" amino acids 4 to 145 (142 residues), 20.8 bits, see alignment E=1e-07 PF00890: FAD_binding_2" amino acids 4 to 40 (37 residues), 32.4 bits, see alignment 3.5e-11 PF12831: FAD_oxidored" amino acids 4 to 48 (45 residues), 35.1 bits, see alignment 5.5e-12 PF13738: Pyr_redox_3" amino acids 6 to 313 (308 residues), 40.4 bits, see alignment E=1.2e-13 PF13450: NAD_binding_8" amino acids 7 to 70 (64 residues), 22.1 bits, see alignment E=8.6e-08 PF00070: Pyr_redox" amino acids 176 to 251 (76 residues), 60.4 bits, see alignment E=1.1e-19 PF02852: Pyr_redox_dim" amino acids 348 to 457 (110 residues), 144.8 bits, see alignment E=6e-46

Best Hits

Swiss-Prot: 52% identical to DLDH_SCHPO: Dihydrolipoyl dehydrogenase, mitochondrial (dld1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 88% identity to phe:Phep_3710)

MetaCyc: 52% identical to glycine cleavage system L protein 1 (Arabidopsis thaliana col)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)" in subsystem TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.4.1.27 or 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZBE3 at UniProt or InterPro

Protein Sequence (468 amino acids)

>CA265_RS24150 dihydrolipoyl dehydrogenase (Pedobacter sp. GW460-11-11-14-LB5)
MQYDVVVIGSGPGGYVGAIRCAQLGLKTAVVEKYKTFGGTCLNVGCIPSKALLDSSEHFH
NAAHTFTTHGINLKDLKVDMKQMIARKDDVVAQNTAGITYLFKKNKIDSFEGVGSFVDKN
TILVTKADGSTETLSAKNVIIATGSKPTALPFLPIDKKRIITSTEALNIKEVPKTMVVIG
GGVIGLELGSVYARLGTKVSVVEFLPSIIGTMDAGLGKELQRVLKKTLGMEFYMGHKVTG
ATTKGKTVTVTADTPKGESISLEADYCIVAVGRTAYSEGLGLDKIGITVEERGKKIPVNE
HLETSVKGVYAIGDVITGAMLAHKAEDEGTYVAETIAGQKPHINYNLIPGVVYTWPEVAS
VGLTEEQLKEKGVKYKAGSFPFKASGRAKASMDTDGFIKVLADAATDEVLGVHMIGPRAA
DMIAEAVIAMEFRASAEDIARTCHAHPTYTEALKEAALAATDNRAIHI