Protein Info for CA265_RS23750 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: translational GTPase TypA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 TIGR00231: small GTP-binding protein domain" amino acids 3 to 144 (142 residues), 82.7 bits, see alignment E=2.6e-27 PF00009: GTP_EFTU" amino acids 3 to 195 (193 residues), 189.2 bits, see alignment E=1.4e-59 TIGR01394: GTP-binding protein TypA/BipA" amino acids 4 to 594 (591 residues), 887.5 bits, see alignment E=3.5e-271 PF01926: MMR_HSR1" amino acids 7 to 128 (122 residues), 21.9 bits, see alignment E=4e-08 PF03144: GTP_EFTU_D2" amino acids 217 to 287 (71 residues), 42.7 bits, see alignment E=1.5e-14 PF00679: EFG_C" amino acids 394 to 477 (84 residues), 75.2 bits, see alignment E=8.9e-25 PF21018: BipA_C" amino acids 481 to 589 (109 residues), 154.8 bits, see alignment E=1.6e-49

Best Hits

Swiss-Prot: 52% identical to TYPA_BACSU: GTP-binding protein TypA/BipA homolog (typA) from Bacillus subtilis (strain 168)

KEGG orthology group: K06207, GTP-binding protein (inferred from 95% identity to phe:Phep_4050)

Predicted SEED Role

"GTP-binding protein TypA/BipA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZB41 at UniProt or InterPro

Protein Sequence (601 amino acids)

>CA265_RS23750 translational GTPase TypA (Pedobacter sp. GW460-11-11-14-LB5)
MQKIRNIAIIAHVDHGKTTLVDKILHSCSIFRDNEQTGDLILDNNDLERERGITIVSKNV
SVQYKDVKINIIDTPGHADFGGEVERVLKMADGVLLLCDAFEGAMPQTRFVTQKALALGL
KPIVVVNKVDKENCRPEEVYEQIFELFFNLEATEDQLDFPVIYGSSKQGWMSTDWKVPTT
DIFALLDAVVANIPPAPINDGTLQMQITSLDYSSFVGRIAIGRVHRGTIKENQPVTLIKR
DGKIVKSRVKELYTFEGLGKIRTSEVSSGDICAVVGIDGFDIGDTIADFEAPEQLPVISI
DEPTMNMLFTINNSPFFGKEGKLVTSQRIKERLYKEMEKNLALKVVETASPDAWLVYGRG
ILHLSVLIETMRREGYEIQVGQPQVIIKEIDGKKHEPIETLIVDVPGEVSGKVIELVTQR
KGELLIMEPKGDLQHLEFEIPARGIIGLRNNVLTATAGEAIMAHRFKAYEPWKGTIPGRL
NGVLVSMEKGQTTAYSIDKLQDRGRFFIDPGTDVYEGQIMGEHIRDNDLVVNVVKGKALT
NMRASGTDDNTRIAPAIKFSLEEAMEYIQADEYIEVTPQSMRLRKIFLTEQERKVKGKQF
A